General Information

  • ID:  hor005832
  • Uniprot ID:  Q09982
  • Protein name:  YGGWG-amide
  • Gene name:  nlp-32
  • Organism:  Caenorhabditis elegans
  • Family:  YARP (YGGW-amide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGWG
  • Length:  5
  • Propeptide:  MRQFNLLLVFCLIALTALPVFSFPNGLTMDSIDMEPMGAFDENGAADESPRVKRYGGWGGRGGWGRGGGRGYGGRGGGWGGRGGGWGRGGGGRGFYGGGRRGWGK
  • Signal peptide:  MRQFNLLLVFCLIALTALPVFS
  • Modification:  T5 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May have antimicrobial activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q09982-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005832_AF2.pdbhor005832_ESM.pdb

Physical Information

Mass: 61009 Formula: C26H30N6O7
Absent amino acids: ACDEFHIKLMNPQRSTV Common amino acids: G
pI: 6.09 Basic residues: 0
Polar residues: 4 Hydrophobic residues: 1
Hydrophobicity: -68 Boman Index: 501
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: 1964 Extinction Coefficient cystines: 6990
Absorbance 280nm: 1747.5

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  11717458
  • Title:  Identification of neuropeptide-like protein gene families in Caenorhabditiselegans and other species.